Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX162957.1 | 3prime_partial | 199 | 1-597(+) |
Amino Acid sequence : | |||
MSPQTETKASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI VGNVFGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDF | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 21,979.678 | ||
Theoretical pI: | 7.641 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 27.455 | ||
aromaticity | 0.116 | ||
GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.226 | ||
sheet | 0.246 |