| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX255728.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| PQTETKASAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVG NVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAE | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,721.627 | ||
| Theoretical pI: | 6.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 30.244 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.217 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX255728.1 | internal | 221 | 2-664(+) |
Amino Acid sequence : | |||
| PQTETKASAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVG NVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAE | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,721.627 | ||
| Theoretical pI: | 6.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
| Instability index: | 30.244 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.217 | ||
| sheet | 0.253 | ||