| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX282947.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
| PTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGN VFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGG | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,275.958 | ||
| Theoretical pI: | 8.003 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 35.172 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.233 | ||
| sheet | 0.244 | ||