| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX282948.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| ETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGG | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,077.739 | ||
| Theoretical pI: | 7.812 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.427 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.230 | ||
| sheet | 0.246 | ||