Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX282949.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
ETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,077.739 | ||
Theoretical pI: | 7.812 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 34.427 | ||
aromaticity | 0.115 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.230 | ||
sheet | 0.246 |