| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX344520.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
| LLRVFLYEYRNCNRLLTKKSVSNFLKRNKRLFFFLYNSHAYEYQSIFVFLRNQSFHLRSISSGALFTRVYFYGKIDYLQKVFTKHFKGILWFFKHPFLHYVRYQGKWILASKSKGTSLLM TKWKYYLVHFWQCHFSVWSQPRRIHINRLSNHPIDFMGFVFSVRLTPSVVRSQMLENSFLIENGIKKFDTLVPIGPLIRSLAKAKFCNVLGHPVSKPVWSDLSDSDIIDRFVRICRNLSH YYSGS | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 29,326.947 | ||
| Theoretical pI: | 10.238 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 54110 | ||
| Instability index: | 39.648 | ||
| aromaticity | 0.180 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.424 | ||
| turn | 0.229 | ||
| sheet | 0.163 | ||