Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX344595.1 | internal | 213 | 2-640(+) |
Amino Acid sequence : | |||
VKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLE DLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQ | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 24,028.994 | ||
Theoretical pI: | 6.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 31.590 | ||
aromaticity | 0.127 | ||
GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.216 | ||
sheet | 0.244 |