Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX344596.1 | internal | 187 | 2-562(+) |
Amino Acid sequence : | |||
ILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGI QVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMLWRDRFLFCA | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,843.544 | ||
Theoretical pI: | 7.814 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 34.681 | ||
aromaticity | 0.118 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.241 | ||
sheet | 0.246 |