Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX344669.1 | internal | 225 | 1-675(+) |
Amino Acid sequence : | |||
TETKAGVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALFKAQ | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,176.275 | ||
Theoretical pI: | 7.539 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 30.249 | ||
aromaticity | 0.124 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.218 | ||
sheet | 0.244 |