| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX344674.1 | internal | 158 | 2-475(+) |
Amino Acid sequence : | |||
| LTYYTPDYQTLDPDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP PAYSKTFQGPPHGIQVERDKLNKYLRALLGCTIKPKLG | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,460.641 | ||
| Theoretical pI: | 5.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 35.163 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.228 | ||
| sheet | 0.259 | ||