Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX344719.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
DILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHG IQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,697.974 | ||
Theoretical pI: | 7.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 38.583 | ||
aromaticity | 0.105 | ||
GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.253 | ||
sheet | 0.259 |