Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX346959.2 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
ETKAGVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEQNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 20,996.625 | ||
Theoretical pI: | 8.377 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 28.242 | ||
aromaticity | 0.116 | ||
GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.232 | ||
sheet | 0.242 |