Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX365262.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGIAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLVEGRAICLHPLVCKGF NADFDGDQMAVHVPLSLEAQAEARLLMFSHM | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,921.743 | ||
Theoretical pI: | 8.993 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 34.793 | ||
aromaticity | 0.060 | ||
GRAVY | 0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.199 | ||
sheet | 0.298 |