Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX365297.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
HRCGLPREIAIELFQTFVIRGLIRQHLASNIGIAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLVEGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAHAEARL | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,352.541 | ||
Theoretical pI: | 7.997 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 36.099 | ||
aromaticity | 0.050 | ||
GRAVY | 0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.176 | ||
sheet | 0.311 |