| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX365301.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| TLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFLIRGLIRQDLAANIGVAKSQIREKEPIVWEILQEVMRGHPVLLNRAPTLHRLGIQAFQPILVEGRAICLHPLVCKGFNAD FDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,584.515 | ||
| Theoretical pI: | 7.776 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.477 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.260 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.214 | ||
| sheet | 0.308 | ||