| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374537.1 | complete | 185 | 1-558(+) |
Amino Acid sequence : | |||
| MATSLALQCSLTQQAFRSHYFRSSSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANG GIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 12,573.084 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.355 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374537.1 | 5prime_partial | 124 | 557-183(-) |
Amino Acid sequence : | |||
| YTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVLTLGVLG GGAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,573.084 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.355 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374537.1 | complete | 185 | 1-558(+) |
Amino Acid sequence : | |||
| MATSLALQCSLTQQAFRSHYFRSSSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANG GIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 12,573.084 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.355 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374537.1 | 5prime_partial | 124 | 557-183(-) |
Amino Acid sequence : | |||
| YTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVLTLGVLG GGAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,573.084 | ||
| Theoretical pI: | 9.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.277 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.355 | ||
| sheet | 0.258 | ||