Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | complete | 184 | 1-555(+) |
Amino Acid sequence : | |||
MATSLTLQCSLTQQAFRSHYSFSALPSFGLLAARRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGG IPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTVDAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | 5prime_partial | 125 | 554-177(-) |
Amino Acid sequence : | |||
YTIGPPFRYSVKAKATRPSMANLPFHNSASTVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNASTSVNFVLTLGVLG GGGAT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
GNLTHITMLADSASIPKPLLFFCPSFFWFVSRPPYLWHGHPLSSRGSRARENNSGNTTSGGSTTTEDTQGQHKIHRRASIQRPGARENQRAVGHGWVCSRSGGGVSKRR* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | complete | 184 | 1-555(+) |
Amino Acid sequence : | |||
MATSLTLQCSLTQQAFRSHYSFSALPSFGLLAARRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGG IPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTVDAELWNGRFAMLGLVALAFTEYLKGGPIV* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | 5prime_partial | 125 | 554-177(-) |
Amino Acid sequence : | |||
YTIGPPFRYSVKAKATRPSMANLPFHNSASTVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNASTSVNFVLTLGVLG GGGAT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374538.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
GNLTHITMLADSASIPKPLLFFCPSFFWFVSRPPYLWHGHPLSSRGSRARENNSGNTTSGGSTTTEDTQGQHKIHRRASIQRPGARENQRAVGHGWVCSRSGGGVSKRR* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,999.251 | ||
Theoretical pI: | 11.545 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 53.725 | ||
aromaticity | 0.083 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.358 | ||
sheet | 0.147 |