Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374539.1 | complete | 179 | 1-540(+) |
Amino Acid sequence : | |||
MCSLTQQQAFRSHYSSALPSLRLLPAHRASGMAIRCQAEGQEPTPVPEKRTPVTPVTPPPPRTPKVSTKFSDVLAFSGPAPERINGRLAMVGFAAAMAVELARGDDLAVQLANGGIPWFV LTAAVFSAASLIPLFKGVTVQSKSDGVMTADAEMWNGRFAMLGLVALVLTEYLKGGPIV* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 13,788.517 | ||
Theoretical pI: | 9.144 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 34.140 | ||
aromaticity | 0.050 | ||
GRAVY | 0.243 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.367 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX374539.1 | 5prime_partial | 139 | 539-120(-) |
Amino Acid sequence : | |||
YTIGPPFRYSVKTKATKPSMANLPFHISASAVITPSDLDCTVTPLKSGISDAAENTAAVKTNHGIPPFASCTARSSPLANSTAIAAANPTMANRPLILSGAGPLNASTSENFVLTLGVLG GGGVTGVTGVLFSGTGVGS* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 13,788.517 | ||
Theoretical pI: | 9.144 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 34.140 | ||
aromaticity | 0.050 | ||
GRAVY | 0.243 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.367 | ||
sheet | 0.237 |