Acc_NO	ORF type	length	start-end position (strand +/-)
>KX374539.1	complete	179	1-540(+)
Amino Acid sequence :
MCSLTQQQAFRSHYSSALPSLRLLPAHRASGMAIRCQAEGQEPTPVPEKRTPVTPVTPPPPRTPKVSTKFSDVLAFSGPAPERINGRLAMVGFAAAMAVELARGDDLAVQLANGGIPWFV LTAAVFSAASLIPLFKGVTVQSKSDGVMTADAEMWNGRFAMLGLVALVLTEYLKGGPIV*
Physicochemical properties
Number of amino acids:		179
Molecular weight:		13,788.517
Theoretical pI:		9.144
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		34.140
aromaticity		0.050
GRAVY		0.243
Secondary Structure Fraction
Helix		0.252
turn		0.367
sheet		0.237

Acc_NO	ORF type	length	start-end position (strand +/-)
>KX374539.1	5prime_partial	139	539-120(-)
Amino Acid sequence :
YTIGPPFRYSVKTKATKPSMANLPFHISASAVITPSDLDCTVTPLKSGISDAAENTAAVKTNHGIPPFASCTARSSPLANSTAIAAANPTMANRPLILSGAGPLNASTSENFVLTLGVLG GGGVTGVTGVLFSGTGVGS*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		13,788.517
Theoretical pI:		9.144
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		34.140
aromaticity		0.050
GRAVY		0.243
Secondary Structure Fraction
Helix		0.252
turn		0.367
sheet		0.237