| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374540.1 | complete | 172 | 1-519(+) |
Amino Acid sequence : | |||
| MATSLTLQCSLMSQQGFRTPPSALPSFGGRASSMSIRCQVGEQEPAPPQAPKTRAPKVVSTKFSDVLAFSGPAPERINGRLAMVGFAAAMAVELARGDDLAVQLANGGIPWFVLTAAVFS AASLIPLFKGVTVQSKSDGVMTADAELWNGRFAMLGLVALIFTEYLKGGPIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,646.407 | ||
| Theoretical pI: | 9.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.414 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.323 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374540.1 | 5prime_partial | 124 | 518-144(-) |
Amino Acid sequence : | |||
| YTMGPPFKYSVKIKATKPSMANLPFHNSASAVITPSDLDCTVTPLKSGISDAAENTAAVKTNHGIPPFASCTARSSPLANSTAIAAANPTMANRPLILSGAGPLKAKTSENLVLTTFGAL VFGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,646.407 | ||
| Theoretical pI: | 9.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.414 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.323 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374540.1 | complete | 172 | 1-519(+) |
Amino Acid sequence : | |||
| MATSLTLQCSLMSQQGFRTPPSALPSFGGRASSMSIRCQVGEQEPAPPQAPKTRAPKVVSTKFSDVLAFSGPAPERINGRLAMVGFAAAMAVELARGDDLAVQLANGGIPWFVLTAAVFS AASLIPLFKGVTVQSKSDGVMTADAELWNGRFAMLGLVALIFTEYLKGGPIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,646.407 | ||
| Theoretical pI: | 9.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.414 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.323 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374540.1 | 5prime_partial | 124 | 518-144(-) |
Amino Acid sequence : | |||
| YTMGPPFKYSVKIKATKPSMANLPFHNSASAVITPSDLDCTVTPLKSGISDAAENTAAVKTNHGIPPFASCTARSSPLANSTAIAAANPTMANRPLILSGAGPLKAKTSENLVLTTFGAL VFGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 12,646.407 | ||
| Theoretical pI: | 9.516 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.414 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.323 | ||
| sheet | 0.282 | ||