| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374542.1 | complete | 206 | 1-621(+) |
Amino Acid sequence : | |||
| MGMVLGKIGVETPKYSLVRTTGEYEIRKYPPSVTAQVTYDPSESGDRGVFTILANYIGAFGDPHNSIPEKKIAMTAPVITSKPEKISMTAPVITTAAGGVKESSSAMTMQFVLPAKYAKA EDAPKPTDERVAIREEGERAYGVVRFSGVAHDKAVEERLERLRGSLERDGYKVVGEFLLARYNPPWITLPPFRTNEVMLPVEQSAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,063.746 | ||
| Theoretical pI: | 10.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 54.373 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.449 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.300 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374542.1 | 5prime_partial | 190 | 621-49(-) |
Amino Acid sequence : | |||
| LSSGLFNRKHDFVSPKRREGDPRRIIPRQKKLPNHLIPIPLQTSPQSLQPLFHCLIMSHTTEPHDPIRSLPFLSYRHPLVGRLRGILRLRVLGRQHKLHSHGGRRLFYPTGSSSDDRCGH RNLLRFTSDDGRGHCNLLLGNGVVGVAESADVVSEDREDASVAALGRVVGHLRGDGGRVFSDFVLSGGAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,063.746 | ||
| Theoretical pI: | 10.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 54.373 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.449 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.300 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374542.1 | complete | 206 | 1-621(+) |
Amino Acid sequence : | |||
| MGMVLGKIGVETPKYSLVRTTGEYEIRKYPPSVTAQVTYDPSESGDRGVFTILANYIGAFGDPHNSIPEKKIAMTAPVITSKPEKISMTAPVITTAAGGVKESSSAMTMQFVLPAKYAKA EDAPKPTDERVAIREEGERAYGVVRFSGVAHDKAVEERLERLRGSLERDGYKVVGEFLLARYNPPWITLPPFRTNEVMLPVEQSAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,063.746 | ||
| Theoretical pI: | 10.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 54.373 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.449 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.300 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374542.1 | 5prime_partial | 190 | 621-49(-) |
Amino Acid sequence : | |||
| LSSGLFNRKHDFVSPKRREGDPRRIIPRQKKLPNHLIPIPLQTSPQSLQPLFHCLIMSHTTEPHDPIRSLPFLSYRHPLVGRLRGILRLRVLGRQHKLHSHGGRRLFYPTGSSSDDRCGH RNLLRFTSDDGRGHCNLLLGNGVVGVAESADVVSEDREDASVAALGRVVGHLRGDGGRVFSDFVLSGGAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,063.746 | ||
| Theoretical pI: | 10.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 54.373 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.449 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.300 | ||
| sheet | 0.195 | ||