| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374543.1 | complete | 166 | 1-501(+) |
Amino Acid sequence : | |||
| MGIYISLLMHLSNFRLFQYIEGANLNWSRIAMTKPVLTSIVPDAGPLHSSAYFVRLYLPSKFQASPPLPLLELNLEPVRWESRCTAVRKFSGFARDSNVVKEAEKLAISLSRSSWANSTD LLGKNAYSIAQYNSPFRKFRRVNEVWVDVDGSQAPGCESQESIAVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 13,133.830 | ||
| Theoretical pI: | 9.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 40.511 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.282 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374543.1 | 5prime_partial | 117 | 501-148(-) |
Amino Acid sequence : | |||
| LIYSYGFLRFTTWCLGPININPDLINATKFPKRGIILSNRVGVLAEQVSRVGPGRSAQADGQLLRLLNNVAVSSKTGELPDSCTSTFPSHWFEVQFQEREGRRGLEFRGQVQPDKIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,133.830 | ||
| Theoretical pI: | 9.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 40.511 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.282 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374543.1 | complete | 166 | 1-501(+) |
Amino Acid sequence : | |||
| MGIYISLLMHLSNFRLFQYIEGANLNWSRIAMTKPVLTSIVPDAGPLHSSAYFVRLYLPSKFQASPPLPLLELNLEPVRWESRCTAVRKFSGFARDSNVVKEAEKLAISLSRSSWANSTD LLGKNAYSIAQYNSPFRKFRRVNEVWVDVDGSQAPGCESQESIAVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 13,133.830 | ||
| Theoretical pI: | 9.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 40.511 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.282 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX374543.1 | 5prime_partial | 117 | 501-148(-) |
Amino Acid sequence : | |||
| LIYSYGFLRFTTWCLGPININPDLINATKFPKRGIILSNRVGVLAEQVSRVGPGRSAQADGQLLRLLNNVAVSSKTGELPDSCTSTFPSHWFEVQFQEREGRRGLEFRGQVQPDKIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,133.830 | ||
| Theoretical pI: | 9.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 40.511 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.282 | ||
| sheet | 0.197 | ||