Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX783714.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
LIPRSVHVEILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLV EEPCMHYIRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLITELAKAKFCNVLGHPIS KPIRAELSDSNIIDRFSRICRNIS | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 31,571.683 | ||
Theoretical pI: | 10.079 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61670 | ||
Instability index: | 44.984 | ||
aromaticity | 0.136 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.428 | ||
turn | 0.227 | ||
sheet | 0.212 |