Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX807128.1 | 3prime_partial | 195 | 1-585(+) |
Amino Acid sequence : | |||
MSPQTETKASVGFKAGVKDYRLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIDPVLGEDNQYIAYVAYPLDLFEEGSVTNMFTSI VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,585.259 | ||
Theoretical pI: | 8.331 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 31.405 | ||
aromaticity | 0.113 | ||
GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.236 | ||
sheet | 0.236 |