Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX807135.1 | 3prime_partial | 195 | 1-585(+) |
Amino Acid sequence : | |||
MSPQTETKAFVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSI VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,531.250 | ||
Theoretical pI: | 7.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 36.846 | ||
aromaticity | 0.118 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.231 | ||
sheet | 0.246 |