| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX807135.1 | 3prime_partial | 195 | 1-585(+) |
Amino Acid sequence : | |||
| MSPQTETKAFVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSI VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,531.250 | ||
| Theoretical pI: | 7.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 36.846 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.231 | ||
| sheet | 0.246 | ||