Acc_NO	ORF type	length	start-end position (strand +/-)
>KY050729.1	complete	100	1-303(+)
Amino Acid sequence :
MARKSLIQRGKAKSTLEQKYHSIRRSSKKEISKVPSLSDKWEIYGKLQSLPRNSAPTRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,534.281
Theoretical pI:		11.189
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		65.658
aromaticity		0.070
GRAVY		-0.763
Secondary Structure Fraction
Helix		0.250
turn		0.260
sheet		0.230