Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY050729.1 | complete | 100 | 1-303(+) |
Amino Acid sequence : | |||
MARKSLIQRGKAKSTLEQKYHSIRRSSKKEISKVPSLSDKWEIYGKLQSLPRNSAPTRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,534.281 | ||
Theoretical pI: | 11.189 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 65.658 | ||
aromaticity | 0.070 | ||
GRAVY | -0.763 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.260 | ||
sheet | 0.230 |