Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY067394.1 | complete | 119 | 577-936(+) |
Amino Acid sequence : | |||
MDAKPLLKEALQASVGLPVDRNIPLIGFIGRLEEQKGSDILVAALHKFIGMDVQVVILVSRLSTIFCLVNTLYDDRHETSCCIRERGRRNSRRRLSNSRRCTLIRLEEWLNSMCRWPIP* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,689.939 | ||
Theoretical pI: | 9.490 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 65.537 | ||
aromaticity | 0.050 | ||
GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.210 | ||
sheet | 0.261 |