Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY081780.1 | complete | 270 | 1-813(+) |
Amino Acid sequence : | |||
MGRAPCCEKVGLKRGRWTAEEDEKLRKYIQENGEGCWRSLPKNAGLLRCGKSCRLRWINYLRSDVKRGNISSQEEEIIINLHASMGNRWSLIAAHLPGRTDNEIKNYWNSHLSRKFHGFR PNPQFIPPPPPPPPSSKPKKTKNSNKKAKAAAKTATAAVVMPTTPTPEKESSVGRPGKERESEARESGSSMVGELDDLNMTEDLSGLWGPTLDFGTGSEISDPGLGQLDNSSLQIYEETL SWIWNDEDDKWNSNVDNGEMDGAMLSWLLS* | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 12,289.048 | ||
Theoretical pI: | 11.522 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 82.181 | ||
aromaticity | 0.112 | ||
GRAVY | -0.810 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.355 | ||
sheet | 0.150 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY081780.1 | complete | 107 | 811-488(-) |
Amino Acid sequence : | |||
MTTTKKALHHPFLRCPRWNSTCRPRRSKSTKAFLRKFATTSYLAGPDPDPKFHFRSRSPVWGPRGRSSPPSYLNRPTLPPWSCRSLSLHFLSPSQVCPPRTLSPEWG* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,289.048 | ||
Theoretical pI: | 11.522 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 82.181 | ||
aromaticity | 0.112 | ||
GRAVY | -0.810 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.355 | ||
sheet | 0.150 |