Acc_NO	ORF type	length	start-end position (strand +/-)
>KY440077.1	internal	150	1-450(+)
Amino Acid sequence :
EYAMGASILNFREFLRRTYSLQRKSRMGDKTRPRLMIVSRRRTRILTNEDEVSEVAKKVGFEVVTAEADTSTNLSRFARLVNSCDVMMGLHGAGLTNMVFLPDNAVLIQLVPLGKIDIFA RLAFGDPAPGMNIKYLEYTISTQESSLTQQ
Physicochemical properties
Number of amino acids:		150
Molecular weight:		14,617.917
Theoretical pI:		10.875
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		40.580
aromaticity		0.091
GRAVY		0.196
Secondary Structure Fraction
Helix		0.341
turn		0.265
sheet		0.235

Acc_NO	ORF type	length	start-end position (strand +/-)
>KY440077.1	3prime_partial	132	398-3(-)
Amino Acid sequence :
MFIPGAGSPKASLAKMSIFPKGTNWIRTALSGRKTMFVRPAPWRPIITSHELTSLANLDRFVDVSASAVTTSNPTFFATSETSSSLVRIRVLLLDTIIRRGRVLSPILDFLCSEYVLRRN SLKFSIDAPIAY
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,617.917
Theoretical pI:		10.875
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		40.580
aromaticity		0.091
GRAVY		0.196
Secondary Structure Fraction
Helix		0.341
turn		0.265
sheet		0.235