Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY448291.1 | 5prime_partial | 207 | 3-626(+) |
Amino Acid sequence : | |||
QDATIVLPRDITNVAIEIKDSEFCWDPSSSSPTLAGIQLKVEKGMRVAVCGVVGSGKSSFLSCILGEIPKISGEVRICGTAAYVSQSAWIQSGTIEDNVLFGSPMDKAKYKAVIHACSLK KDLELFSHGDQTIIGDRGINLSGGQKQRVQLARALYQDGDIYLLDDPFSAVDAHTGSELFKEYILTALATKTVVFLLTRLNFCQLLM* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 22,434.579 | ||
Theoretical pI: | 5.625 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 33.181 | ||
aromaticity | 0.072 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.222 | ||
sheet | 0.242 |