Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469202.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
LLRLFLHEYSNWNSIIPPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYQGKSILTSKDTPLLM NKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICRNLSH YYSGSSK | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 29,097.597 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55350 55600 | ||
Instability index: | 43.375 | ||
aromaticity | 0.170 | ||
GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.263 | ||
sheet | 0.215 |