Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469203.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
SLHLLRLFLHEYSNWNSIIPPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYQGKSILTSKDTP LLMNKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICRN LSHYYSGSSKKKGLYRIKYIL | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 30,811.702 | ||
Theoretical pI: | 9.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58330 58580 | ||
Instability index: | 41.025 | ||
aromaticity | 0.169 | ||
GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.257 | ||
sheet | 0.215 |