Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469205.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
LHLLRLFLHEYSNWNSIIPPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYQGKSILTSKDTPL LMNKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICRNL SHYYSGSSKK | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 29,476.066 | ||
Theoretical pI: | 9.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55350 55600 | ||
Instability index: | 42.975 | ||
aromaticity | 0.168 | ||
GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.260 | ||
sheet | 0.216 |