Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469207.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
LHLLRLFLHEYSNWNSIIPPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYQGKSILTSKDTPL LMNKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICRNL SHYYSGSSKKK | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 29,604.238 | ||
Theoretical pI: | 9.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55350 55600 | ||
Instability index: | 42.844 | ||
aromaticity | 0.167 | ||
GRAVY | -0.030 | ||
Secondary Structure Fraction | |||
Helix | 0.402 | ||
turn | 0.259 | ||
sheet | 0.215 |