Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469216.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
LHLLRLFLHEYSNWNSIIPPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYQGKSILTSKDTPL LMNKWKYYLIYLWQCYFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMDNAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHICRNL SHYYSGSSKKKSLYRI | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 30,236.990 | ||
Theoretical pI: | 9.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 57090 | ||
Instability index: | 41.541 | ||
aromaticity | 0.168 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.258 | ||
sheet | 0.215 |