Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY469231.1 | internal | 264 | 2-793(+) |
Amino Acid sequence : | |||
ASSLHLLRLFLHEYSNWNSIITPKNSVFIFSKSNPRLFLFLYNSHVCEYESILLFLRNQPSHLRLMSSGSFFERIFFYAKIKHPVEEVFANDFSATPWFFKAPFMHYVRYRGKSILTSKD TPLLMNKWKYYLIYLWQCSFYVWSQPTRIYINPLSKHSLAFLGYFSSIRLNLSVVRSQMLKNAFIMENAMKRLDTLVPISPLIGSLAKMKFCNGLGHPVSKSIWADSSDLDIIDRFAHIC RNLSHYYSGSSKKKGLYRIKYILR | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 31,096.019 | ||
Theoretical pI: | 9.892 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 57090 | ||
Instability index: | 40.549 | ||
aromaticity | 0.163 | ||
GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.402 | ||
turn | 0.258 | ||
sheet | 0.220 |