Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496333.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
ETKASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,491.868 | ||
Theoretical pI: | 7.007 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 19.364 | ||
aromaticity | 0.113 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.220 | ||
sheet | 0.249 |