Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496343.1 | internal | 185 | 3-557(+) |
Amino Acid sequence : | |||
KASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,445.974 | ||
Theoretical pI: | 8.355 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 20.061 | ||
aromaticity | 0.119 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.222 | ||
sheet | 0.243 |