Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496347.1 | internal | 138 | 3-416(+) |
Amino Acid sequence : | |||
DYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNGFGFKALRALRLEDLRIPAAYTKT FQGPPHGIQVERDKLNKY | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,264.891 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 23.747 | ||
aromaticity | 0.116 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.217 | ||
sheet | 0.261 |