Acc_NO	ORF type	length	start-end position (strand +/-)
>KY496348.1	internal	165	3-497(+)
Amino Acid sequence :
FKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPILGCTIKPK
Physicochemical properties
Number of amino acids:		165
Molecular weight:		18,377.618
Theoretical pI:		6.929
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27390 27515
Instability index:		22.242
aromaticity		0.121
GRAVY		-0.372
Secondary Structure Fraction
Helix		0.309
turn		0.212
sheet		0.230