Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496360.1 | internal | 187 | 3-563(+) |
Amino Acid sequence : | |||
ASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK ALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRG | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,644.196 | ||
Theoretical pI: | 8.373 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 21.559 | ||
aromaticity | 0.118 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.225 | ||
sheet | 0.246 |