Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496368.1 | internal | 190 | 2-571(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,046.639 | ||
Theoretical pI: | 8.315 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 22.837 | ||
aromaticity | 0.116 | ||
GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.216 | ||
sheet | 0.247 |