Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496381.1 | internal | 180 | 1-540(+) |
Amino Acid sequence : | |||
AGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 19,997.461 | ||
Theoretical pI: | 7.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 23.787 | ||
aromaticity | 0.117 | ||
GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.217 | ||
sheet | 0.250 |