Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496383.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
GVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRL EDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPK | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,031.194 | ||
Theoretical pI: | 6.165 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 22.207 | ||
aromaticity | 0.117 | ||
GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.216 | ||
sheet | 0.235 |