Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496384.1 | internal | 105 | 2-316(+) |
Amino Acid sequence : | |||
LAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,482.801 | ||
Theoretical pI: | 4.698 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 26.937 | ||
aromaticity | 0.114 | ||
GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.229 | ||
sheet | 0.305 |