Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496386.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
FKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,272.807 | ||
Theoretical pI: | 8.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 22.809 | ||
aromaticity | 0.121 | ||
GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.214 | ||
sheet | 0.247 |