Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496387.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
TETKASVGFKAGVKDYKLTYYTPDYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNV FGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNY | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 19,998.420 | ||
Theoretical pI: | 7.629 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 20.222 | ||
aromaticity | 0.116 | ||
GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.221 | ||
sheet | 0.243 |