Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496412.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQMAVHVPLSLEAQAEAR | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,034.575 | ||
Theoretical pI: | 8.584 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 37.509 | ||
aromaticity | 0.063 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.201 | ||
sheet | 0.278 |