Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496413.1 | internal | 143 | 2-430(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQMAVHVPLSLEAQAEA | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,878.389 | ||
Theoretical pI: | 7.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 37.701 | ||
aromaticity | 0.063 | ||
GRAVY | 0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.203 | ||
sheet | 0.280 |