Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496414.1 | internal | 136 | 1-408(+) |
Amino Acid sequence : | |||
FRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGF NADFDGDQMAVHVPLS | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,165.641 | ||
Theoretical pI: | 8.966 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.127 | ||
aromaticity | 0.066 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.213 | ||
sheet | 0.250 |