Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY496421.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
RETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIKQHFASNIGVAKSKIREKEPVVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEGHAICLHPLVCKGFN ADFDGDQMA | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,385.716 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 39.215 | ||
aromaticity | 0.062 | ||
GRAVY | 0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.209 | ||
sheet | 0.256 |